PDB entry 4p7j

View 4p7j on RCSB PDB site
Description: Rat apo-COMT sulfate bound
Class: transferase
Keywords: methyltransferase, neurotransmitter degradation, transferase, alternative initiation, catecholamine metabolism, cell membrane, metal-binding, phosphoprotein, s-adenosyl-l-methionine, signal-anchor, transmembrane anchor, enzyme mechanism, conformational change
Deposited on 2014-03-27, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.168
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p7ja_
  • Heterogens: K, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p7jA (A:)
    mgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireysps
    lvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasq
    dlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfl
    ayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p7jA (A:)
    gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
    vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd
    lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
    yvrgsssfecthyssyleymkvvdglekaiyqgpssp