PDB entry 4p7i

View 4p7i on RCSB PDB site
Description: Crystal structure of the Merlin FERM/DCAF1 complex
Class: Signaling Protein/Protein Binding
Keywords: Signaling Protein-Protein Binding complex
Deposited on 2014-03-27, released 2014-04-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2, Nf-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4p7ia1, d4p7ia2, d4p7ia3
  • Chain 'B':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2, Nf-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4p7ib1, d4p7ib2, d4p7ib3
  • Chain 'C':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: VPRBP, DCAF1, KIAA0800, RIP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: protein vprbp
    Species: Homo sapiens [TaxId:9606]
    Gene: VPRBP, DCAF1, KIAA0800, RIP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p7iA (A:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p7iA (A:)
    pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd
    kkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeas
    vllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgr
    ardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpw
    neirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p7iB (B:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p7iB (B:)
    tftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkk
    vldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeasvl
    lasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgrar
    deaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwne
    irnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.