PDB entry 4p6s

View 4p6s on RCSB PDB site
Description: Crystal Structure of tyrosinase from Bacillus megaterium with L-DOPA in the active site
Class: oxidoreductase
Keywords: L-DOPA, type 3 copper proteins, OXIDOREDUCTASE
Deposited on 2014-03-25, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p6sa_
  • Chain 'B':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p6sb_
  • Heterogens: ZN, DAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p6sA (A:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p6sA (A:)
    yrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmssa
    flpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikdf
    ivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwdm
    tsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqii
    hrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p6sB (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel