PDB entry 4p6r

View 4p6r on RCSB PDB site
Description: Crystal Structure of tyrosinase from Bacillus megaterium with tyrosine in the active site
Class: oxidoreductase
Keywords: tyrosine, type 3 copper proteins, OXIDOREDUCTASE
Deposited on 2014-03-25, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p6ra_
  • Chain 'B':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p6rb_
  • Heterogens: ZN, TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p6rA (A:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p6rB (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p6rB (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie