PDB entry 4p5u

View 4p5u on RCSB PDB site
Description: Crystal structure of TatD
Class: hydrolase
Keywords: DNA repair, DNA processing, exonuclease, TIM barrel, HYDROLASE
Deposited on 2014-03-20, released 2014-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tat-linked quality control protein TatD
    Species: Escherichia coli [TaxId:83333]
    Gene: tatD, mttC, yigW, yigX, b4483, JW5931
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27859 (0-259)
      • expression tag (260-261)
    Domains in SCOPe 2.08: d4p5ua1, d4p5ua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p5uA (A:)
    mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag
    vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl
    nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde
    rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged
    aawlaattdanvktlfgiafle