PDB entry 4p5p

View 4p5p on RCSB PDB site
Description: X-ray structure of Francisella tularensis Rapid Encystment Protein 24 KDa (REP24), gene product of FTN_0841
Class: hydrolase
Keywords: Hydrolase, cysteine protease, virulence factor, flavodoxin-like
Deposited on 2014-03-19, released 2015-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ThiJ/pfpI family protein
    Species: Francisella tularensis subsp. novicida [TaxId:401614]
    Gene: FTN_0841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4p5pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p5pA (A:)
    mknvlmvttshdvmgnsnektglwlselthpyysiidkninidivsimggeipidpnsva
    qedyyndkfladdnlknimknstslrdvnikeydaiifagghgtmwdfpnnanihskvld
    iyakngvigaichgvaalinvkdnngqniirdkevtgfsnneekivgltdvvpfsledsl
    veagakyssasewqsyvksdskiitaqnpqsatdfakaikqslfn