PDB entry 4p5m

View 4p5m on RCSB PDB site
Description: Structural Basis of Chronic Beryllium Disease: Bridging the Gap Between Allergic Hypersensitivity and Autoimmunity
Class: immune system
Keywords: CBD, autoimmunity, beryllium, IMMUNE SYSTEM
Deposited on 2014-03-18, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p5ma1, d4p5ma2
  • Chain 'B':
    Compound: peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1
    Database cross-references and differences (RAF-indexed):
    • PDB 4P5M (0-11)
      • linker (12)
    • Uniprot Q5EP54 (Start-211)
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p5mc1, d4p5mc2
  • Chain 'D':
    Compound: peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1
    Database cross-references and differences (RAF-indexed):
    • PDB 4P5M (0-11)
      • linker (12)
    • Uniprot Q5EP54 (Start-211)
  • Chain 'E':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p5me1, d4p5me2
  • Chain 'F':
    Compound: peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1
    Database cross-references and differences (RAF-indexed):
    • PDB 4P5M (0-11)
      • linker (12)
    • Uniprot Q5EP54
  • Chain 'G':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p5mg1, d4p5mg2
  • Chain 'H':
    Compound: peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1
    Database cross-references and differences (RAF-indexed):
    • PDB 4P5M (0-11)
      • linker (12)
    • Uniprot Q5EP54 (25-End)
      • variant (25)
  • Heterogens: NA, NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p5mA (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p5mA (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4p5mC (C:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p5mC (C:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4p5mE (E:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p5mE (E:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4p5mG (G:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p5mG (G:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    

  • Chain 'H':
    No sequence available.