PDB entry 4p5k

View 4p5k on RCSB PDB site
Description: Structural Basis of Chronic Beryllium Disease: Bridging the Gap Between Allergy and Autoimmunity
Class: immune system
Keywords: MHC, TCR, complex, HLA, Chronic Beryllium Disease, allergy, autoimmunity, IMMUNE SYSTEM
Deposited on 2014-03-17, released 2015-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p5ka1, d4p5ka2
  • Chain 'B':
    Compound: RAS peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1
    Database cross-references and differences (RAF-indexed):
    • PDB 4P5K (0-11)
      • linker (12-14)
    • Uniprot Q5EP54 (25-211)
      • variant (25)
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p5kd1, d4p5kd2
  • Chain 'E':
    Compound: RAS peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1
    Database cross-references and differences (RAF-indexed):
    • PDB 4P5K (0-11)
      • linker (12-14)
    • Uniprot Q5EP54 (25-211)
      • variant (25)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p5kA (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p5kA (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    q
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4p5kD (D:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p5kD (D:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    q
    

  • Chain 'E':
    No sequence available.