PDB entry 4p4r

View 4p4r on RCSB PDB site
Description: Structural Basis of Chronic Beryllium Disease: Bridging the Gap Between Allergic Hypersensitivity and Autoimmunity
Class: immune system
Keywords: HLA-DP2, immune system, allergy, berylliosis
Deposited on 2014-03-13, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-07, with a file datestamp of 2015-01-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.199
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p4ra1, d4p4ra2
  • Chain 'B':
    Compound: mim2 peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1, HLA-DP1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4R (0-10)
      • linker (11)
    • Uniprot P04440 (25-211)
      • variant (25)
      • variant (58)
      • variant (77-78)
      • variant (91)
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p4rc1, d4p4rc2
  • Chain 'D':
    Compound: mim2 peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1, HLA-DP1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4R (0-10)
      • linker (11)
    • Uniprot P04440 (25-211)
      • variant (25)
      • variant (58)
      • variant (77-78)
      • variant (91)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p4rA (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4rA (A:)
    kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
    niailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvtw
    lcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4p4rC (C:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4rC (C:)
    kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
    niailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvtw
    lcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwe
    

  • Chain 'D':
    No sequence available.