PDB entry 4p4k

View 4p4k on RCSB PDB site
Description: Structural Basis of Chronic Beryllium Disease: Bridging the Gap Between allergic hypersensitivity and auto immunity
Class: immune system
Keywords: Be bound complex, Chronic beryllium disease, TCR-MHC peptide-Be2+, IMMUNE SYSTEM
Deposited on 2014-03-12, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-07, with a file datestamp of 2015-01-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p4ka1, d4p4ka2
  • Chain 'B':
    Compound: mim2 peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1, HLA-DP1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4K (0-10)
      • linker (11)
    • Uniprot P04440 (25-211)
      • variant (25)
      • variant (58)
      • variant (77-78)
      • variant (91)
  • Chain 'C':
    Compound: hTCRav22 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4K
    Domains in SCOPe 2.07: d4p4kc1, d4p4kc2
  • Chain 'D':
    Compound: hTCRav22 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4K (Start-241)
    Domains in SCOPe 2.07: d4p4kd1, d4p4kd2
  • Chain 'E':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p4ke1, d4p4ke2
  • Chain 'F':
    Compound: mim2 peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1, HLA-DP1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4K (0-10)
      • linker (11)
    • Uniprot P04440 (25-211)
      • variant (25)
      • variant (58)
      • variant (77-78)
      • variant (91)
  • Chain 'G':
    Compound: hTCRav22 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4K
    Domains in SCOPe 2.07: d4p4kg1, d4p4kg2
  • Chain 'H':
    Compound: hTCRav22 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P4K
    Domains in SCOPe 2.07: d4p4kh1, d4p4kh2
  • Heterogens: NAG, NA, 0BE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p4kA (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4kA (A:)
    kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
    niailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvtw
    lcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4p4kC (C:)
    mnsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnk
    gfeatyrkettsfhlekgsvqvsdsavyfcalslysgagsyqltfgkgtklsvipniqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4kC (C:)
    nsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkg
    featyrkettsfhlekgsvqvsdsavyfcalslysgagsyqltfgkgtklsvipniqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4p4kD (D:)
    mgvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfp
    grfsgrqfsnsrsemnvstlelgdsalylcasslaqggetqyfgpgtrllvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4kD (D:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcasslaqggetqyfgpgtrllvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4p4kE (E:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4kE (E:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    q
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4p4kG (G:)
    mnsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnk
    gfeatyrkettsfhlekgsvqvsdsavyfcalslysgagsyqltfgkgtklsvipniqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4kG (G:)
    svtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkgf
    eatyrkettsfhlekgsvqvsdsavyfcalslysgagsyqltfgkgtklsvipniqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4p4kH (H:)
    mgvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfp
    grfsgrqfsnsrsemnvstlelgdsalylcasslaqggetqyfgpgtrllvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p4kH (H:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcasslaqggetqyfgpgtrllvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr