PDB entry 4p49

View 4p49 on RCSB PDB site
Description: The structure of a chicken anti-prostate specific antigen scFv
Class: immune system
Keywords: recombinant antibody, chicken, cardiac troponin I, scFv, immunoglobulin, phage display, immune system
Deposited on 2014-03-12, released 2014-04-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody scFv B8
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P49 (0-End)
    Domains in SCOPe 2.07: d4p49a1, d4p49a2
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p49A (A:)
    altqpssvsanpgetvkitcsgssgsygwyqqkspdsapvtviyqsnqrpsdipsrfsgs
    ksgstgtltitgvqaedeavyycggwgssvgmfgagttltvlgqssrssggggssggggs
    avtldesggglqtpggalslvckasgftfssyamgwvrqapgkglewvagisddgdsyis
    yatavkgratisrdngqstvrlqlnnlraedtatyycarshcsgcrnaalidawghgtev
    ivsstsgqagqhhhhhhgaypydvpdyas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p49A (A:)
    altqpssvsanpgetvkitcsgssgsygwyqqkspdsapvtviyqsnqrpsdipsrfsgs
    ksgstgtltitgvqaedeavyycggwgssvgmfgagttltvlgavtldesggglqtpgga
    lslvckasgftfssyamgwvrqapgkglewvagisddgdsyisyatavkgratisrdngq
    stvrlqlnnlraedtatyycarshcsgcrnaalidawghgtevivs