PDB entry 4p44

View 4p44 on RCSB PDB site
Description: X-ray structure of human glutamate carboxypeptidase II (GCPII) in complex with a phosphoramidate inhibitor JRB-4-81
Class: hydrolase
Keywords: prostate-specific membrane antigen, NAALADase, phosphoramidate, hydrolase
Deposited on 2014-03-11, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA, GIG27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p44a1, d4p44a2, d4p44a3
  • Heterogens: NAG, BMA, MAN, ZN, CA, CL, 2F7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p44A (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p44A (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytknwetngyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdc
    rdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfsnpi
    vlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskv
    dpskawgevkrqiyvaaftvqaaaetlseva