PDB entry 4p1c

View 4p1c on RCSB PDB site
Description: crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Class: oxidoreductase
Keywords: electron-transfer complex, oxidoreductase, diiron enzyme complex, iron-sulfur, reduction, hydroxylase ferredoxin, oxygenase
Deposited on 2014-02-26, released 2014-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toluene-4-monooxygenase system protein A
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00456 (0-489)
      • see remark 999 (334-335)
    Domains in SCOPe 2.07: d4p1ca_
  • Chain 'B':
    Compound: Toluene-4-monooxygenase system protein E
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoE
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Toluene-4-monooxygenase system protein B
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p1cc_
  • Chain 'D':
    Compound: Toluene-4-monooxygenase system protein A
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00456 (0-489)
      • see remark 999 (334-335)
    Domains in SCOPe 2.07: d4p1cd_
  • Chain 'E':
    Compound: Toluene-4-monooxygenase system protein E
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoE
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Toluene-4-monooxygenase system protein B
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p1cf_
  • Chain 'H':
    Compound: Toluene-4-monooxygenase system ferredoxin subunit
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00458 (0-110)
      • engineered mutation (5)
      • engineered mutation (82-83)
    Domains in SCOPe 2.07: d4p1ch_
  • Chain 'I':
    Compound: Toluene-4-monooxygenase system ferredoxin subunit
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: tmoC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00458 (0-110)
      • engineered mutation (5)
      • engineered mutation (82-83)
    Domains in SCOPe 2.07: d4p1ci_
  • Heterogens: FE, PEG, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p1cA (A:)
    amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
    qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
    gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
    grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
    lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
    ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
    ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
    ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
    dahdfawadk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p1cC (C:)
    safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
    prdmtiaesglnptevidvvfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p1cD (D:)
    amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi
    qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap
    gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit
    grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa
    lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq
    ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek
    ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh
    ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk
    dahdfawadk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p1cF (F:)
    safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
    prdmtiaesglnptevidvvfe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p1cH (H:)
    sfekisslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
    itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p1cI (I:)
    sfekisslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
    itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs