PDB entry 4p18

View 4p18 on RCSB PDB site
Description: Crystal Structure of frog M ferritin mutant D80K
Class: oxidoreductase
Keywords: oxidoreductase, ferroxidase, point mutation, intersubunit electrostatic interactions, frog-M ferritin mutant D80K
Deposited on 2014-02-25, released 2014-10-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'B':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'C':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'D':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'E':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'F':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'G':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'H':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'I':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'J':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'K':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'L':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'M':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'N':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'O':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
    Domains in SCOPe 2.04: d4p18o_
  • Chain 'P':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'Q':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'R':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'S':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'T':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'U':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'V':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'W':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Chain 'X':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (80)
  • Heterogens: SO4, EDO, ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4p18O (O:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqkikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p18O (O:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqkikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.