PDB entry 4p08

View 4p08 on RCSB PDB site
Description: Engineered thermostable dimeric cocaine esterase
Class: hydrolase
Keywords: esterase, disulfide-linked dimer, cocaine, mutant, HYDROLASE
Deposited on 2014-02-20, released 2014-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cocaine esterase
    Species: Rhodococcus sp. [TaxId:51612]
    Gene: cocE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L9D7 (0-570)
      • engineered mutation (168-169)
      • engineered mutation (192)
      • engineered mutation (297)
    Domains in SCOPe 2.04: d4p08a1, d4p08a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p08A (A:)
    gnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwlefv
    rdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgvtq
    wqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligrqlitsrsdarp
    edaadfvqlaaicndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislfer
    lgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgcaa
    typiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytpfyl
    ggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrpihd
    rddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgivrm
    ryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntggvia
    reqleemctavnrihrgpehpshivlpiikr