PDB entry 4ozh

View 4ozh on RCSB PDB site
Description: S16 protein complex
Class: immune system
Keywords: immune receptor-ligand complex, immune system
Deposited on 2014-02-16, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ozha1, d4ozha2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ozhb1, d4ozhb2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ozhc1, d4ozhc2
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ozhd1, d4ozhd2
  • Chain 'E':
    Compound: T-cell receptor, s16, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZH (0-End)
    Domains in SCOPe 2.07: d4ozhe1, d4ozhe2
  • Chain 'F':
    Compound: T-cell receptor, s16, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZH (0-End)
    Domains in SCOPe 2.07: d4ozhf1, d4ozhf2
  • Chain 'G':
    Compound: T-cell receptor, s16, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZH (0-End)
    Domains in SCOPe 2.07: d4ozhg1, d4ozhg2
  • Chain 'H':
    Compound: T-cell receptor, s16, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZH (0-End)
    Domains in SCOPe 2.07: d4ozhh1, d4ozhh2
  • Chain 'I':
    Compound: Gliadin-alpha2 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZH (0-End)
  • Chain 'J':
    Compound: Gliadin-alpha2 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZH (0-12)
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ozhA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhA (A:)
    ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
    tniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ozhB (B:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgef
    ravtllglpaaeywnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqspitvewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhB (B:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispshnllvcsvtdfypaqikv
    rwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewr
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ozhC (C:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhC (C:)
    ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
    tniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ozhD (D:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgef
    ravtllglpaaeywnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqspitvewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhD (D:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispshnllvcsvtdfypaqikv
    rwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewr
    a
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ozhE (E:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivwggatnklifgtgtllavqpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhE (E:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivwggatnklifgtgtllavqpniqnpdpavyq
    lrdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ozhF (F:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhF (F:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ozhG (G:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivwggatnklifgtgtllavqpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhG (G:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivwggatnklifgtgtllavqpniqnpdpavyq
    lrdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ozhH (H:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozhH (H:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassvrstdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.