PDB entry 4ozg

View 4ozg on RCSB PDB site
Description: D2 protein complex
Class: immune system
Keywords: immune receptor-ligand complex, immune system
Deposited on 2014-02-16, released 2014-04-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.205
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: T-cell receptor, d2, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZG (0-End)
    Domains in SCOPe 2.04: d4ozge1, d4ozge2
  • Chain 'F':
    Compound: T-cell receptor, d2, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZG
    Domains in SCOPe 2.04: d4ozgf1, d4ozgf2
  • Chain 'G':
    Compound: T-cell receptor, d2, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZG (0-End)
  • Chain 'H':
    Compound: T-cell receptor, d2, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZG
    Domains in SCOPe 2.04: d4ozgh1, d4ozgh2
  • Chain 'I':
    Compound: deamidated Gliadin-alpha2 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZG (0-12)
  • Chain 'J':
    Compound: deamidated Gliadin-alpha2 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZG (0-End)
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ozgE (E:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivlggadgltfgkgthliiqpyiqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfa
    canafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozgE (E:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivlggadgltfgkgthliiqpyiqnpdpavyql
    rdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacan
    afnnsiipedtffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ozgF (F:)
    mgvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglp
    sdrfsaertggsvstltiqrtqqedsavylcassfrftdtqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozgF (F:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassfrftdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ozgH (H:)
    mgvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglp
    sdrfsaertggsvstltiqrtqqedsavylcassfrftdtqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozgH (H:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassfrftdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.