PDB entry 4ozf

View 4ozf on RCSB PDB site
Description: JR5.1 protein complex
Class: immune system
Keywords: immune receptor-ligand complex, immune system
Deposited on 2014-02-15, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ozfa1, d4ozfa2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ozfb1, d4ozfb2
  • Chain 'G':
    Compound: T-cell receptor, jr5.1 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZF (0-End)
    Domains in SCOPe 2.07: d4ozfg1, d4ozfg2
  • Chain 'H':
    Compound: T-cell receptor, jr5.1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZF
    Domains in SCOPe 2.07: d4ozfh1, d4ozfh2
  • Chain 'J':
    Compound: deamidated Gliadin-alpha2 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZF (0-12)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ozfA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozfA (A:)
    ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
    tniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ozfB (B:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgef
    ravtllglpaaeywnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqspitvewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozfB (B:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispshnllvcsvtdfypaqikv
    rwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewr
    a
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ozfG (G:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyyciafqgaqklvfgqgtrltinpniqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfa
    canafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozfG (G:)
    mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyyciafqgaqklvfgqgtrltinpniqnpdpavyql
    rdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdacana
    fnnsiipedtffp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ozfH (H:)
    mgvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglp
    sdrfsaertggsvstltiqrtqqedsavylcassfralaadtqyfgpgtrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ozfH (H:)
    gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
    drfsaertggsvstltiqrtqqedsavylcassfralaadtqyfgpgtrltvledlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    ra
    

  • Chain 'J':
    No sequence available.