PDB entry 4oz4

View 4oz4 on RCSB PDB site
Description: X-ray structure of the DC8E8 Fab apo-form crystallized at pH 8.5 and refined to 3.0 A.
Class: immune system
Keywords: Fab, apo-form, IMMUNE SYSTEM
Deposited on 2014-02-13, released 2015-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab of monoclonal antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZ4 (0-219)
  • Chain 'B':
    Compound: Fab of monoclonal antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZ4 (0-217)
    Domains in SCOPe 2.07: d4oz4b1, d4oz4b2
  • Chain 'H':
    Compound: Fab of monoclonal antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZ4 (0-219)
  • Chain 'L':
    Compound: Fab of monoclonal antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OZ4 (0-217)
    Domains in SCOPe 2.07: d4oz4l1, d4oz4l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oz4B (B:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oz4L (L:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne