PDB entry 4oyh

View 4oyh on RCSB PDB site
Description: Structure of Bacillus subtilis MobB
Class: biosynthetic protein
Keywords: Molybdenum, MobB
Deposited on 2014-02-12, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdopterin-guanine dinucleotide biosynthesis protein B
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: BSUW23_07340,mobB
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0U3U4 (10-End)
      • expression tag (9)
      • engineered mutation (87)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d4oyha1, d4oyha2
  • Chain 'B':
    Compound: Molybdopterin-guanine dinucleotide biosynthesis protein B
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: BSUW23_07340,mobB
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0U3U4 (10-End)
      • expression tag (8-9)
      • engineered mutation (87)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d4oyhb1, d4oyhb2
  • Chain 'C':
    Compound: Molybdopterin-guanine dinucleotide biosynthesis protein B
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: BSUW23_07340,mobB
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0U3U4 (10-End)
      • expression tag (9)
      • engineered mutation (87)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d4oyhc1, d4oyhc2
  • Chain 'D':
    Compound: Molybdopterin-guanine dinucleotide biosynthesis protein B
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: BSUW23_07340,mobB
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0U3U4 (10-End)
      • expression tag (9)
      • engineered mutation (87)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d4oyhd1, d4oyhd2
  • Chain 'E':
    Compound: Molybdopterin-guanine dinucleotide biosynthesis protein B
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: BSUW23_07340,mobB
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0U3U4 (10-End)
      • expression tag (9)
      • engineered mutation (87)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d4oyhe1, d4oyhe2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oyhA (A:)
    masmalvrpfpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegk
    dtdryqaagadvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvv
    ilsekedlealktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkgesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oyhA (A:)
    fpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlt
    arrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkk
    ehmtehqglpifhaddpvavdlvlsqlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oyhB (B:)
    masmalvrpfpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegk
    dtdryqaagadvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvv
    ilsekedlealktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkgesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oyhB (B:)
    pfpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlql
    tarrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrk
    kehmtehqglpifhaddpvavdlvlsqlkges
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oyhC (C:)
    masmalvrpfpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegk
    dtdryqaagadvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvv
    ilsekedlealktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkgesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oyhC (C:)
    fpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlt
    arrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkk
    ehmtehqglpifhaddpvavdlvlsqlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oyhD (D:)
    masmalvrpfpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegk
    dtdryqaagadvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvv
    ilsekedlealktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkgesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oyhD (D:)
    fpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlt
    arrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkk
    ehmtehqglpifhaddpvavdlvlsqlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4oyhE (E:)
    masmalvrpfpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegk
    dtdryqaagadvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvv
    ilsekedlealktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkgesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oyhE (E:)
    fpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlt
    arrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkk
    ehmtehqglpifhaddpvavdlvlsqlkge