PDB entry 4oxr

View 4oxr on RCSB PDB site
Description: Structure of Staphylococcus pseudintermedius metal-binding protein SitA in complex with Manganese
Class: metal binding protein
Keywords: Manganese binding protein, SBP, ABC transporter, METAL BINDING PROTEIN
Deposited on 2014-02-05, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Manganese ABC transporter, periplasmic-binding protein SitA
    Species: Staphylococcus pseudintermedius [TaxId:283734]
    Gene: SPSE_2131
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oxra_
  • Chain 'B':
    Compound: Manganese ABC transporter, periplasmic-binding protein SitA
    Species: Staphylococcus pseudintermedius [TaxId:283734]
    Gene: SPSE_2131
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oxrb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oxrA (A:)
    ggdesehklkivttnsilydmtknitgdkaeihsivpvgqdpheyeikpkdvqaltdadv
    iiyngfnlesgngwfekalkqanksikddsviqasknvkpiylkqgeksehnidphawls
    lgngieyvktiksalenadkthakdydkqgteylskleklnkeskdkfndipkekrvmit
    segafkyfaqqfdvkpgyiweintenqgtpeqmkqavdfvkenhiknllletsvsdksmk
    slgeetgakiygtvytdsigkkgsdgdsyykmmesniktihesmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oxrA (A:)
    klkivttnsilydmtknitgdkaeihsivpvgqdpheyeikpkdvqaltdadviiyngfn
    lesgngwfekalkqanksikddsviqasknvkpiylkqgeksehnidphawlslgngiey
    vktiksalenadkthakdydkqgteylskleklnkeskdkfndipkekrvmitsegafky
    faqqfdvkpgyiweintenqgtpeqmkqavdfvkenhiknllletsvsdksmkslgeetg
    akiygtvytdsigkkgsdgdsyykmmesniktihesmq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oxrB (B:)
    ggdesehklkivttnsilydmtknitgdkaeihsivpvgqdpheyeikpkdvqaltdadv
    iiyngfnlesgngwfekalkqanksikddsviqasknvkpiylkqgeksehnidphawls
    lgngieyvktiksalenadkthakdydkqgteylskleklnkeskdkfndipkekrvmit
    segafkyfaqqfdvkpgyiweintenqgtpeqmkqavdfvkenhiknllletsvsdksmk
    slgeetgakiygtvytdsigkkgsdgdsyykmmesniktihesmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oxrB (B:)
    klkivttnsilydmtknitgdkaeihsivpvgqdpheyeikpkdvqaltdadviiyngfn
    lesgngwfekalkqanksikddsviqasknvkpiylkqgeksehnidphawlslgngiey
    vktiksalenadkthakdydkqgteylskleklnkeskdkfndipkekrvmitsegafky
    faqqfdvkpgyiweintenqgtpeqmkqavdfvkenhiknllletsvsdksmkslgeetg
    akiygtvytdsigkkgsdgdsyykmmesniktihesmq