PDB entry 4ov2

View 4ov2 on RCSB PDB site
Description: Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 2014-02-19, released 2014-03-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal calcium sensor 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NCS1, FLUP, FREQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ov2a_
  • Chain 'B':
    Compound: neuronal calcium sensor 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NCS1, FLUP, FREQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ov2b_
  • Chain 'C':
    Compound: neuronal calcium sensor 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NCS1, FLUP, FREQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ov2c_
  • Chain 'D':
    Compound: neuronal calcium sensor 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NCS1, FLUP, FREQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ov2d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ov2A (A:)
    gamgksnsklkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpf
    gdptkfatfvfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitr
    nemldivdaiyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegskadp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov2A (A:)
    ltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatfvfnvfden
    kdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgnt
    tpekrvdrifammdknadgkltlqefqegsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ov2B (B:)
    gamgksnsklkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpf
    gdptkfatfvfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitr
    nemldivdaiyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegskadp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov2B (B:)
    lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf
    vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda
    iyqmvgntventpekrvdrifammdknadgkltlqefqegska
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ov2C (C:)
    gamgksnsklkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpf
    gdptkfatfvfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitr
    nemldivdaiyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegskadp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov2C (C:)
    lkpevveeltrktyftekevqqwykgfildaagfqkiykqffpfgdptkfatfvfnvfde
    nkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgn
    tvelntpekrvdrifammdknadgkltlqefqegsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ov2D (D:)
    gamgksnsklkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpf
    gdptkfatfvfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitr
    nemldivdaiyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegskadp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov2D (D:)
    lkpevveeltrktyftekevqqwykgfikdcpldaagfqkiykqffpfgdptkfatfvfn
    vfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyq
    mvgntvelpeeentpekrvdrifammdknadgkltlqefqegs