PDB entry 4ous

View 4ous on RCSB PDB site
Description: Crystal structure of zebrafish Caprin-2 C1q domain
Class: signaling protein
Keywords: C1q domain, Wnt signaling, SIGNALING PROTEIN
Deposited on 2014-02-18, released 2014-10-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caprin-2
    Species: Danio rerio [TaxId:7955]
    Gene: caprin2, rng140, si:ch211-11c20.4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ousa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ousA (A:)
    mtqlrvafsaartanfapgtldqpiafdllhtnlgdmfdtgsgrftcpatgayvfifhil
    klaisvplyinlmrneevmvsayandgapdhetasnhavlqlfqgdqvwlrlhrgaiygs
    swkystfsgfllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ousA (A:)
    lrvafsaartanfapgtldqpiafdllhtnlgdmfdtgsgrftcpatgayvfifhilkla
    isvplyinlmrneevmvsayandgapdhetasnhavlqlfqgdqvwlrlhrgaiygsswk
    ystfsgfllyqd