PDB entry 4oul

View 4oul on RCSB PDB site
Description: Crystal structure of human Caprin-2 C1q domain
Class: signaling protein
Keywords: C1q domain, Wnt signaling, SIGNALING PROTEIN
Deposited on 2014-02-17, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IMN6 (Start-131)
      • expression tag (132)
    Domains in SCOPe 2.07: d4oula1, d4oula2
  • Chain 'B':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oulb_
  • Chain 'C':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oulc_
  • Chain 'D':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ould_
  • Chain 'E':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oule_
  • Chain 'F':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oulf_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oulA (A:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oulA (A:)
    rvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlklav
    nvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswky
    stfsgyllyqdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oulB (B:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oulB (B:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oulC (C:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oulC (C:)
    rvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlklav
    nvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswky
    stfsgyllyqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oulD (D:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oulD (D:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4oulE (E:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oulE (E:)
    mrvafsaartsnpgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlklavn
    vplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswkys
    tfsgyllyqd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4oulF (F:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oulF (F:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqd