PDB entry 4ou2

View 4ou2 on RCSB PDB site
Description: A 2.15 Angstroms X-ray crystal structure of E268A 2-aminomuconate 6-semialdehyde dehydrogenase catalytic intermediate from Pseudomonas fluorescens
Class: oxidoreductase
Keywords: Aldehyde dehydrogenase, Dehydrogenase, NAD, oxidoreductase
Deposited on 2014-02-14, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V33 (0-482)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d4ou2a_
  • Chain 'B':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V33 (0-482)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d4ou2b_
  • Chain 'C':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V33 (0-482)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d4ou2c_
  • Chain 'D':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V33 (0-482)
      • engineered mutation (250)
    Domains in SCOPe 2.07: d4ou2d_
  • Heterogens: NAD, NA, 6OA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ou2A (A:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ou2B (B:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ou2C (C:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ou2D (D:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfalggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki