PDB entry 4ot1

View 4ot1 on RCSB PDB site
Description: Structural Basis for the Recognition of Human Cytomegalovirus Glycoprotein B by the Neutralizing Human Antibody SM5-1
Class: viral protein/immune system
Keywords: Immunoglobulin, PH domain, Antibody-Antigen Recognition, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2014-02-13, released 2014-08-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.174
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein B
    Species: Human cytomegalovirus [TaxId:10363]
    Gene: gB, UL55
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13201 (Start-29)
      • linker (30-33)
    • Uniprot P13201 (34-End)
      • engineered mutation (87-88)
  • Chain 'H':
    Compound: SM5-1 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OT1 (0-End)
  • Chain 'L':
    Compound: SM5-1 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OT1 (0-End)
    Domains in SCOPe 2.04: d4ot1l1, d4ot1l2
  • Heterogens: EDO, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ot1L (L:)
    qsvltqppsvsaapgqmvtiscsgsssnigknyvswyqqlpgaapkllifdnnkrpsgtp
    drfsgsksgtsatlvitglqtgdeadyycgtpdrslsvvfgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ot1L (L:)
    qsvltqppsvsaapgqmvtiscsgsssnigknyvswyqqlpgaapkllifdnnkrpsgtp
    drfsgsksgtsatlvitglqtgdeadyycgtpdrslsvvfgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptec