PDB entry 4osu

View 4osu on RCSB PDB site
Description: Crystal structure of HCMV gB-neutralizing SM5-1 Fab fragment
Class: immune system
Keywords: Immunoglobulin, Immune response, HCMV neutralization, HCMV glycoprotein B, IMMUNE SYSTEM
Deposited on 2014-02-13, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: SM5-1 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OSU (0-End)
  • Chain 'L':
    Compound: SM5-1 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OSU (0-End)
    Domains in SCOPe 2.07: d4osul1, d4osul2
  • Heterogens: FMT, NA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4osuL (L:)
    qsvltqppsvsaapgqmvtiscsgsssnigknyvswyqqlpgaapkllifdnnkrpsgtp
    drfsgsksgtsatlvitglqtgdeadyycgtpdrslsvifgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4osuL (L:)
    qsvltqppsvsaapgqmvtiscsgsssnigknyvswyqqlpgaapkllifdnnkrpsgtp
    drfsgsksgtsatlvitglqtgdeadyycgtpdrslsvifgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt