PDB entry 4or0

View 4or0 on RCSB PDB site
Description: Crystal Structure of Bovine Serum Albumin in complex with naproxen
Class: transport protein
Keywords: Bovine Serum Albumin, BSA, Helical protein possessing three domains, Transport protein, Fatty acids, hormones, metabolites, drugs, naproxen, plasma
Deposited on 2014-02-10, released 2014-06-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.185
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (Start-582)
      • variant (189)
    Domains in SCOPe 2.04: d4or0a1, d4or0a2, d4or0a3
  • Chain 'B':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (Start-582)
      • variant (189)
  • Heterogens: NPS, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4or0A (A:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4or0A (A:)
    thkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshag
    cekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpnt
    lcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpki
    etmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvh
    kecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipenl
    ppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecca
    kddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstpt
    lvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkccteslv
    nrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkatee
    qlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

  • Chain 'B':
    No sequence available.