PDB entry 4oqq

View 4oqq on RCSB PDB site
Description: Structure of the effector-binding domain of deoxyribonucleoside regulator DeoR from Bacillus subtilis
Class: transcription
Keywords: Rossmann Fold, Sugar-binding transcriptional regulator, Schiff base, TRANSCRIPTION
Deposited on 2014-02-10, released 2014-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deoxyribonucleoside regulator
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: deoR, yxxC, BSU39430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oqqa_
  • Chain 'B':
    Compound: Deoxyribonucleoside regulator
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: deoR, yxxC, BSU39430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oqqb_
  • Heterogens: BCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oqqA (A:)
    gidpftdpfedldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdg
    divgvswgttmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmpr
    ylplpvvfdnadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeek
    allkkqavgdicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihg
    altgkyanvliidqhtaralvndl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oqqA (A:)
    edldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswgt
    tmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvfd
    nadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqavg
    dicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyanv
    liidqhtaralvnd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oqqB (B:)
    gidpftdpfedldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdg
    divgvswgttmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmpr
    ylplpvvfdnadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeek
    allkkqavgdicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihg
    altgkyanvliidqhtaralvndl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oqqB (B:)
    edldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswgt
    tmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvfd
    nadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqavg
    dicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyanv
    liidqhtaralvnd