PDB entry 4oqh

View 4oqh on RCSB PDB site
Description: Crystal structure of stabilized TEM-1 beta-lactamase variant v.13 carrying R164S mutation in complex with boron-based inhibitor EC25
Class: hydrolase/hydrolase inhibitor
Keywords: Beta-lactamase, hydrolase-hydrolase inhibitor complex
Deposited on 2014-02-09, released 2015-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extended spectrum beta-lactamase TEM-63
    Species: Escherichia coli [TaxId:562]
    Gene: blaTEM-63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AGJ5 (0-262)
      • engineered mutation (16)
      • engineered mutation (26)
      • engineered mutation (78)
      • engineered mutation (94)
      • engineered mutation (158)
      • engineered mutation (175)
      • engineered mutation (237)
    Domains in SCOPe 2.08: d4oqha_
  • Heterogens: EDO, CA, 2UL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oqhA (A:)
    hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldswepelneaipnderdtttpvamattlrklltgelltaasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymtg
    sqatmdernrqiaeigaslikhw