PDB entry 4opq

View 4opq on RCSB PDB site
Description: Room temperature crystal structure of stabilized TEM-1 beta-lactamase variant v.13 carrying R164S/G238S mutations
Class: hydrolase
Keywords: Beta-Lactamase, HYDROLASE
Deposited on 2014-02-06, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TEM-94 ES-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: bla-TEM-94
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KMX3 (0-262)
      • engineered mutation (16)
      • engineered mutation (26)
      • engineered mutation (78)
      • engineered mutation (94)
      • engineered mutation (138)
      • engineered mutation (158)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d4opqa_
  • Heterogens: CA, PG4, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4opqA (A:)
    hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldswepelneaipnderdtttpvamattlrklltgelltaasrq
    qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
    sqatmdernrqiaeigaslikhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4opqA (A:)
    hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldswepelnderdtttpvamattlrklltgelltaasrqqlidw
    meadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtgsqatm
    dernrqiaeigaslikhw