PDB entry 4ooi

View 4ooi on RCSB PDB site
Description: Reduced HlyU from Vibrio cholerae N16961
Class: DNA binding protein
Keywords: Winged helix, DNA-binding domain, Hemolysin gene transcription regulator, DNA BINDING PROTEIN
Deposited on 2014-02-03, released 2014-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.261
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ooia_
  • Chain 'B':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ooib_
  • Chain 'C':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ooic_
  • Chain 'D':
    Compound: Transcriptional activator HlyU
    Species: Vibrio cholerae [TaxId:243277]
    Gene: hlyU, VC_0678
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ooid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ooiA (A:)
    gshmmpylkgapmnlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlel
    sqsalsqhlawlrrdglvntrkeaqtvfytlsstevkamiellhrlycqanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ooiA (A:)
    lqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlrr
    dglvntrkeaqtvfytlsstevkamiellhrlycq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ooiB (B:)
    gshmmpylkgapmnlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlel
    sqsalsqhlawlrrdglvntrkeaqtvfytlsstevkamiellhrlycqanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ooiB (B:)
    nlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlr
    rdglvntrkeaqtvfytlsstevkamiellhrlycq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ooiC (C:)
    gshmmpylkgapmnlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlel
    sqsalsqhlawlrrdglvntrkeaqtvfytlsstevkamiellhrlycqanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ooiC (C:)
    lqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlrr
    dglvntrkeaqtvfytlsstevkamiellhrlyc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ooiD (D:)
    gshmmpylkgapmnlqemeknsakavvllkamanerrlqilcmlldnelsvgelssrlel
    sqsalsqhlawlrrdglvntrkeaqtvfytlsstevkamiellhrlycqanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ooiD (D:)
    meknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlrrdgl
    vntrkeaqtvfytlsstevkamiellhrlycq