PDB entry 4oo4

View 4oo4 on RCSB PDB site
Description: Crystal Structure of Human Thioredoxin Mutant
Class: oxidoreductase
Keywords: oxidoreductase, S-nitrosation
Deposited on 2014-01-30, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.137
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered mutation (62)
      • engineered mutation (68)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d4oo4a_
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered mutation (62)
      • engineered mutation (68)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d4oo4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oo4A (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcadvasesevksmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oo4B (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcadvasesevksmptfqffkkgqkvgefsgankekleatinelv