PDB entry 4onh

View 4onh on RCSB PDB site
Description: Crystal Structure of DN6 TCR
Class: immune system
Keywords: Ig fold, TCR, Antigen recognition, MHC like, IMMUNE SYSTEM
Deposited on 2014-01-28, released 2014-10-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.26
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ONH (0-End)
    Domains in SCOPe 2.05: d4onha1, d4onha2
  • Chain 'B':
    Compound: T-cell receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TRAV,TRAC,TRAB
    Database cross-references and differences (RAF-indexed):
    • PDB 4ONH (Start-242)
    Domains in SCOPe 2.05: d4onhb1, d4onhb2
  • Heterogens: NAG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4onhA (A:)
    pkvvqsplslvvhegdtvtlncsyevtnfrsllwykqekkaptflfmltssgiekksgrl
    ssildkkelfsilnitatqtgdsavylcawaggtsygkltfgqgtiltvhpniqkpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4onhA (A:)
    pkvvqsplslvvhegdtvtlncsyevtnfrsllwykqekkaptflfmltssgiekksgrl
    ssildkkelfsilnitatqtgdsavylcawaggtsygkltfgqgtiltvhpniqkpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4onhB (B:)
    nagvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgev
    pngynvsrsttedfplrlelaapsqtsvyfcasrhglasyeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4onhB (B:)
    agvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevp
    ngynvsrsttedfplrlelaapsqtsvyfcasrhglasyeqyfgpgtrltvtedlknvfp
    pevavfepseaeisatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqsryals
    srlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad