PDB entry 4omz

View 4omz on RCSB PDB site
Description: Crystal Structure of NolR from Sinorhizobium fredii
Class: transcription
Keywords: helix-turn-helix, transcription regulator, TRANSCRIPTION
Deposited on 2014-01-28, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.205
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omza_
  • Chain 'B':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omzb_
  • Chain 'C':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omzc_
  • Chain 'D':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omzd_
  • Chain 'E':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omze_
  • Chain 'F':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omzf_
  • Chain 'G':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omzg_
  • Chain 'H':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omzh_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omzA (A:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzA (A:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4omzB (B:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzB (B:)
    mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
    klraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4omzC (C:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzC (C:)
    mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
    klraqnlvstrrdaqtiyyssssdsvmkilgalseiygaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4omzD (D:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzD (D:)
    mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
    klraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4omzE (E:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzE (E:)
    mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
    klraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4omzF (F:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzF (F:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyga
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4omzG (G:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzG (G:)
    mqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhls
    klraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4omzH (H:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omzH (H:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyg