PDB entry 4omy

View 4omy on RCSB PDB site
Description: Crystal Structure of SeMet NolR from Sinorhizobium fredii in complex with oligo AT DNA
Class: transcription/DNA
Keywords: helix-turn-helix, transcription regulator, TRANSCRIPTION-DNA complex
Deposited on 2014-01-28, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.134
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omya_
  • Chain 'B':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omyb_
  • Chain 'C':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omyc_
  • Chain 'D':
    Compound: NolR
    Species: Sinorhizobium fredii [TaxId:380]
    Gene: nolR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omyd_
  • Chain 'E':
    Compound: DNA (5 -d(*tp*ap*tp*tp*ap*gp*ap*gp*ap*ap*cp*cp*cp*tp*gp*ap*ap*gp*tp*tp*ap*a)-3 )
  • Chain 'F':
    Compound: DNA (5 -d(*tp*ap*ap*tp*cp*tp*cp*tp*tp*gp*gp*gp*ap*cp*tp*tp*cp*ap*ap*tp*tp*a)-3 )
  • Chain 'G':
    Compound: DNA (5 -d(*tp*ap*tp*tp*ap*gp*ap*gp*ap*ap*cp*cp*cp*tp*gp*ap*ap*gp*tp*tp*ap*a)-3 )
  • Chain 'H':
    Compound: DNA (5 -d(*tp*ap*ap*tp*cp*tp*cp*tp*tp*gp*gp*gp*ap*cp*tp*tp*cp*ap*ap*tp*tp*a)-3 )

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omyA (A:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omyA (A:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4omyB (B:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omyB (B:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4omyC (C:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omyC (C:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4omyD (D:)
    mehamqplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsals
    qhlsklraqnlvstrrdaqtiyyssssdsvmkilgalseiygaatsvviekpfvrksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omyD (D:)
    qplspekheeaeiaagflsamanpkrllildslvkeemavgalankvglsqsalsqhlsk
    lraqnlvstrrdaqtiyyssssdsvmkilgalseiyg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.