PDB entry 4omq

View 4omq on RCSB PDB site
Description: Crystal structure of the intertwined dimer of the c-Src tyrosine kinase SH3 domain mutant S94A
Class: transferase
Keywords: beta-barrel sandwich, kinase, proline rich motifs, TRANSFERASE
Deposited on 2014-01-27, released 2015-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (21-76)
      • expression tag (20)
      • engineered mutation (30)
      • engineered mutation (64)
    Domains in SCOPe 2.08: d4omqa1, d4omqa2
  • Heterogens: PGE, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omqA (A:)
    mgsshhhhhhssglvprgshmtfvalydyeartetdlsfkkgerlqivnntegdwwlahs
    lttgrtgyipsnyvaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omqA (A:)
    mtfvalydyeartetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps