PDB entry 4omp

View 4omp on RCSB PDB site
Description: Crystal structure of the intertwined dimer of the c-Src tyrosine kinase SH3 domain mutant Q128K
Class: transferase
Keywords: beta-barrel sandwich, kinase, proline rich motifs, TRANSFERASE
Deposited on 2014-01-27, released 2014-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase Src
  Species: Gallus gallus [TaxId:9031]
  Gene: SRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00523 (21-75)
    • expression tag (20)
    • engineered mutation (64)
  Domains in SCOPe 2.08: d4ompa1, d4ompa2
• Heterogens: PGE, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4ompA (A:)
  mgsshhhhhhssglvprgshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahs
  lttgktgyipsnyvap
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ompA (A:)
  mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgktgyipsnyvap