PDB entry 4omo

View 4omo on RCSB PDB site
Description: Crystal structure of the c-Src tyrosine kinase SH3 domain mutant Q128E
Class: transferase
Keywords: beta-barrel sandwich, kinase, proline rich motifs, TRANSFERASE
Deposited on 2014-01-27, released 2014-12-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.149
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase Src
  Species: Gallus gallus [TaxId:9031]
  Gene: SRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00523 (4-60)
    • expression tag (0-3)
    • engineered mutation (47)
  Domains in SCOPe 2.06: d4omoa1, d4omoa2
• Chain 'B':
  Compound: Proto-oncogene tyrosine-protein kinase Src
  Species: Gallus gallus [TaxId:9031]
  Gene: SRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00523 (4-End)
    • expression tag (0-3)
    • engineered mutation (47)
  Domains in SCOPe 2.06: d4omob1, d4omob2
• Heterogens: NI, EPE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4omoA (A:)
  gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvaps
  d
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4omoB (B:)
  gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvaps
  d
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4omoB (B:)
  gshmtfvalydyesrtetdlsfkkgerlqivntegdwwlahslttgetgyipsnyvaps