PDB entry 4okv
View 4okv on RCSB PDB site
Description: Crystal structure of anopheline anti-platelet protein with Fab antibody
Class: blood clotting
Keywords: malaria vector mosquito, collagen binding protein, BLOOD CLOTTING
Deposited on
2014-01-23, released
2014-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-04-30, with a file datestamp of
2014-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: heavy chain of 8H7 mAb
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: light chain of 8H7 mAb
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4okvb1, d4okvb2 - Chain 'C':
Compound: heavy chain of 8H7 mAb
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: light chain of 8H7 mAb
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4okvd1, d4okvd2 - Chain 'E':
Compound: Anti-platelet aggregation protein
Species: Anopheles stephensi [TaxId:30069]
Gene: ansg-1, aapp
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Anti-platelet aggregation protein
Species: Anopheles stephensi [TaxId:30069]
Gene: ansg-1, aapp
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4okvB (B:)
dvvmtqtpltlsvtigqpasiackssqslldsdgktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrna
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>4okvD (D:)
dvvmtqtpltlsvtigqpasiackssqslldsdgktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrna
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.