PDB entry 4okv

View 4okv on RCSB PDB site
Description: Crystal structure of anopheline anti-platelet protein with Fab antibody
Class: blood clotting
Keywords: malaria vector mosquito, collagen binding protein, BLOOD CLOTTING
Deposited on 2014-01-23, released 2014-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain of 8H7 mAb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OKV (0-End)
  • Chain 'B':
    Compound: light chain of 8H7 mAb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OKV (0-217)
    Domains in SCOPe 2.04: d4okvb1, d4okvb2
  • Chain 'C':
    Compound: heavy chain of 8H7 mAb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OKV (0-214)
  • Chain 'D':
    Compound: light chain of 8H7 mAb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OKV (0-217)
  • Chain 'E':
    Compound: Anti-platelet aggregation protein
    Species: Anopheles stephensi [TaxId:30069]
    Gene: ansg-1, aapp
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Anti-platelet aggregation protein
    Species: Anopheles stephensi [TaxId:30069]
    Gene: ansg-1, aapp
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4okvB (B:)
    dvvmtqtpltlsvtigqpasiackssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrna
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.