PDB entry 4okh

View 4okh on RCSB PDB site
Description: Crystal structure of calpain-3 penta-EF-hand domain
Class: Hydrolase
Keywords: calcium-binding, EF-hand, Hydrolase
Deposited on 2014-01-22, released 2014-05-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.202
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calpain-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CAN3, CANP3, CANPL3, CAPN3, NCL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20807 (Start-180)
      • expression tag (181-185)
    Domains in SCOPe 2.06: d4okha1, d4okha2
  • Chain 'B':
    Compound: Calpain-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CAN3, CANP3, CANPL3, CAPN3, NCL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20807 (Start-180)
      • expression tag (181)
    Domains in SCOPe 2.06: d4okhb1, d4okhb2
  • Chain 'C':
    Compound: Calpain-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CAN3, CANP3, CANPL3, CAPN3, NCL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4okhc_
  • Heterogens: CA, PEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4okhA (A:)
    mgssdqeseeqqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsm
    ialmdtdgsgklnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnn
    qlydiitmryadkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmy
    alehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4okhA (A:)
    qqqfrnifkqiagddmeicadelkkvlntvvnkthgftlescrsmialmdtdgsgklnlq
    efhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryadkhm
    nidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmyalehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4okhB (B:)
    mgssdqeseeqqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsm
    ialmdtdgsgklnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnn
    qlydiitmryadkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmy
    alehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4okhB (B:)
    eseeqqqfrnifkqiagddmeicadelkkvlntvvnthgftlescrsmialmdtdgsgkl
    nlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryad
    khmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmyal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4okhC (C:)
    mgssdqeseeqqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsm
    ialmdtdgsgklnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnn
    qlydiitmryadkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmy
    alehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4okhC (C:)
    dmeicadelkkvlntvvhgftlescrsmialmdtdgsgklnlqefhhlwnkikawqkifk
    hydtdqsgtinsyemrnavndagfhlnnqlydiitmryadkhmnidfdsficcfvrlegm
    frafhafdkdgdgiiklnvlewlqltm