PDB entry 4oiv

View 4oiv on RCSB PDB site
Description: Structural basis for small molecule NDB as a selective antagonist of FXR
Class: nuclear protein receptor
Keywords: bile acid sensor, nuclear, NUCLEAR PROTEIN RECEPTOR
Deposited on 2014-01-20, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4, BAR, FXR, HRR1, RIP14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RI1 (0-225)
      • engineered mutation (188)
      • engineered mutation (222)
    Domains in SCOPe 2.06: d4oiva_
  • Chain 'B':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4, BAR, FXR, HRR1, RIP14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RI1 (0-225)
      • engineered mutation (188)
      • engineered mutation (222)
    Domains in SCOPe 2.06: d4oivb_
  • Heterogens: XX9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oivA (A:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
    pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
    penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oivA (A:)
    eltpdqqtllhfimdsynksaeenfliltematnhvqvlveftkklpgfqtldhedqial
    lkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyitpmfsfyksigelkmtq
    eeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpqhfaellgrlte
    lrtfnhhhaemlmswrvndhkftplleeiw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oivB (B:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
    pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
    penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oivB (B:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnsdlleerirnsgisdeyitpmfsfyk
    sigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpqhf
    aellgrltelrtfnhhhaemlmswrvndhktplleeiw