PDB entry 4oii
View 4oii on RCSB PDB site
Description: West Nile Virus NS1 in complex with neutralizing 22NS1 antibody Fab
Class: viral protein/immune system
Keywords: West Nile Virus, ANTIBODY, FAB, NEUTRALIZING, FLAVIVIRUS, NON-STRUCTURAL PROTEIN, NS1, VIRAL PROTEIN-IMMUNE SYSTEM COMPLEX, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on
2014-01-19, released
2014-03-05
The last revision prior to the SCOPe 2.06 freeze date was dated
2014-04-23, with a file datestamp of
2014-04-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.216
AEROSPACI score: 0.17
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Non-structural protein NS1
Species: West Nile virus [TaxId:11082]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Non-structural protein NS1
Species: West Nile virus [TaxId:11082]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Heavy Chain of Fab fragment of 22NS1 Antibody
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Heavy Chain of Fab fragment of 22NS1 Antibody
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Light Chain of Fab fragment of 22NS1 Antibody
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4oiil1, d4oiil2 - Chain 'M':
Compound: Light Chain of Fab fragment of 22NS1 Antibody
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4oiim1, d4oiim2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>4oiiL (L:)
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsasgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne
- Chain 'M':
Sequence; same for both SEQRES and ATOM records: (download)
>4oiiM (M:)
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsasgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne