PDB entry 4oii

View 4oii on RCSB PDB site
Description: West Nile Virus NS1 in complex with neutralizing 22NS1 antibody Fab
Class: viral protein/immune system
Keywords: West Nile Virus, ANTIBODY, FAB, NEUTRALIZING, FLAVIVIRUS, NON-STRUCTURAL PROTEIN, NS1, VIRAL PROTEIN-IMMUNE SYSTEM COMPLEX, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2014-01-19, released 2014-03-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.216
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein NS1
    Species: West Nile virus [TaxId:11082]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Non-structural protein NS1
    Species: West Nile virus [TaxId:11082]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Heavy Chain of Fab fragment of 22NS1 Antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OII (0-216)
  • Chain 'I':
    Compound: Heavy Chain of Fab fragment of 22NS1 Antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OII (0-216)
  • Chain 'L':
    Compound: Light Chain of Fab fragment of 22NS1 Antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OII (0-212)
    Domains in SCOPe 2.06: d4oiil1, d4oiil2
  • Chain 'M':
    Compound: Light Chain of Fab fragment of 22NS1 Antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OII (0-212)
    Domains in SCOPe 2.06: d4oiim1, d4oiim2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oiiL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsasgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oiiM (M:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsasgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne