PDB entry 4oht

View 4oht on RCSB PDB site
Description: Crystal structure of succinic semialdehyde dehydrogenase from Streptococcus pyogenes in complex with NADP+ as the cofactor
Class: oxidoreductase
Keywords: SSADH, GabD, OXIDOREDUCTASE, Rossmann Fold, Dehydrogenase, NADP Binding
Deposited on 2014-01-18, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate-semialdehyde dehydrogenase
    Species: Streptococcus pyogenes MGAS1882 [TaxId:1010840]
    Gene: gabD, MGAS1882_0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ohta_
  • Chain 'B':
    Compound: Succinate-semialdehyde dehydrogenase
    Species: Streptococcus pyogenes MGAS1882 [TaxId:1010840]
    Gene: gabD, MGAS1882_0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ohtb_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ohtA (A:)
    mayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilr
    rdrdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkq
    stgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeags
    itnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiild
    dadwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpet
    tlaplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqe
    ifgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwts
    lpelpfggikhsgygrelselgftsfvnehliyipnktnnsntkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohtA (A:)
    ayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilrr
    drdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkqs
    tgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeagsi
    tnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiildd
    adwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpett
    laplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqei
    fgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwtsl
    pelpfggikhsgygrelselgftsfvnehliyipn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ohtB (B:)
    mayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilr
    rdrdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkq
    stgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeags
    itnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiild
    dadwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpet
    tlaplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqe
    ifgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwts
    lpelpfggikhsgygrelselgftsfvnehliyipnktnnsntkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohtB (B:)
    ayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilrr
    drdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkqs
    tgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeagsi
    tnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiildd
    adwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpett
    laplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqei
    fgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwtsl
    pelpfggikhsgygrelselgftsfvnehliyipn