PDB entry 4ohl

View 4ohl on RCSB PDB site
Description: LEOPARD Syndrome-Associated SHP2/T468M mutant
Class: hydrolase
Keywords: sh2 domain, phosphatase domain, hydrolase
Deposited on 2014-01-17, released 2014-09-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP2C, PTPN11, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (467)
    Domains in SCOPe 2.05: d4ohla1, d4ohla2, d4ohla3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP2C, PTPN11, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (467)
    Domains in SCOPe 2.05: d4ohlb1, d4ohlb2, d4ohlb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ohlA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgmfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohlA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgkea
    eklltekgkhgsflvresqshpgdfvlsvrtgskvthvmircqelkydvgggerfdsltd
    lvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckll
    ysrkegqrqenknknryknilpfdhtrvvlhsdyinaniimpksyiatqgclqntvndfw
    rmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelk
    lskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsag
    igrtgmfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyi
    etlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ohlB (B:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgmfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohlB (B:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgkea
    eklltekgkhgsflvresqshpgdfvlsvrtgskvthvmircqelkydvgggerfdsltd
    lvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckll
    ysrkegqrqenknknryknilpfdhtrvvlhdsdyinaniimpksyiatqgclqntvndf
    wrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrel
    klskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsa
    gigrtgmfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhy
    ietlq