PDB entry 4oh2

View 4oh2 on RCSB PDB site
Description: Crystal Structure of Cu/Zn Superoxide Dismutase I149T
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2014-01-16, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2b_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2c_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2d_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2e_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2f_
  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2g_
  • Chain 'H':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2h_
  • Chain 'I':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2i_
  • Chain 'J':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: Homo sapiens SOD1, SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (110)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d4oh2j_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2A (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2B (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2C (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2D (D:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2E (E:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2F (F:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2G (G:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2H (H:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2I (I:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oh2J (J:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvtgiaq