PDB entry 4og8

View 4og8 on RCSB PDB site
Description: Human menin with bound inhibitor MIV-6R
Class: protein binding/inhibitor
Keywords: PROTEIN BINDING-INHIBITOR complex
Deposited on 2014-01-15, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.152
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4og8a1, d4og8a2
  • Heterogens: TBF, 2SF, PG4, SO4, DMS, PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4og8A (A:)
    ggsssmglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgl
    tyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfk
    drahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtae
    vtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdsle
    llqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrd
    ehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnl
    lkeaaslleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrf
    egqvrqkvrivsvpaptaspppegpvltfqsekmkgmkellvatkinssaiklqltaqsq
    vqmkkqkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4og8A (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
    dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
    slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
    gnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdslellqlqq
    kllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrdehiypy
    mylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnllkeaas
    lleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrq
    kvrivsvpgpvltfqsekmkgmkellvatkinssaiklqltaqsqvqmk