PDB entry 4og5

View 4og5 on RCSB PDB site
Description: Human menin with bound inhibitor MIV-5
Class: protein binding/inhibitor
Keywords: PROTEIN BINDING-INHIBITOR complex
Deposited on 2014-01-15, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4og5a1, d4og5a2
  • Heterogens: 2S7, SO4, PG4, PEG, DMS, TBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4og5A (A:)
    ggsssmglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgl
    tyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfk
    drahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtae
    vtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdsle
    llqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrd
    ehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnl
    lkeaaslleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrf
    egqvrqkvrivsvpapvltfqsekmkgmkellvatkinssaiklqltaqsqvqmkkqkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4og5A (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
    dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
    slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
    gnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdslellqlqq
    kllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrdehiypy
    mylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnllkeaas
    lleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrq
    kvrivsvpapvltfqsekmkgmkellvatkinssaiklqltaqsqvqmk