PDB entry 4oe6

View 4oe6 on RCSB PDB site
Description: Crystal Structure of Yeast ALDH4A1
Class: oxidoreductase
Keywords: PUT2P, ALDEHYDE DEHYDROGENASE, ALDH4A1, ROSSMANN FOLD, OXIDOREDUCTASE, NAD, mitochondria
Deposited on 2014-01-11, released 2014-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PUT2, YHR037W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4oe6a_
  • Chain 'B':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PUT2, YHR037W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4oe6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oe6A (A:)
    mdhhhhhhhhasenlyfqghmkppkhirnepvkpfrnidlkdwdllraslmkfkssslev
    plvingeriydnneralfpqtnpanhqqvlanvtqatekdvmnavkaakdakkdwynlpf
    ydrsaiflkaadlistkyrydmlaatmlgqgknvyqaeidcitelsdffryyvkyasdly
    aqqpvesadgtwnkaeyrplegfvyavspfnftaiaanligapalmgntvvwkpsqtaal
    snyllmtvleeaglpkgvinfipgdpvqvtdqvladkdfgalhftgstnvfkslygkiqs
    gvvegkyrdypriigetggknfhlvhpsanishavlstirgtfefqgqkcsaasrlylpe
    skseeflsdmfgilqsqnvvpmntsaspisggnlrgfmgpviheqsfdklvkviedakkd
    peleilyggqydksqgwfvgptvikakrpdhpymsteffgpiltvyeypdtefneicdii
    dntsqyaltgaifakdrkaieyadeklkfsagnfyindkctgavvsqqwfggarmsgtdd
    kaggpnilsrfvsirntkenfyeltdfkypsnyeelgsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oe6A (A:)
    dwdllraslmkfkssslevplvingeriydnneralfpqtnpanhqqvlanvtqatekdv
    mnavkaakdakkdwynlpfydrsaiflkaadlistkyrydmlaatmlgqgknvyqaeidc
    itelsdffryyvkyasdlyaqqpvesadgtwnkaeyrplegfvyavspfnftaiaanlig
    apalmgntvvwkpsqtaalsnyllmtvleeaglpkgvinfipgdpvqvtdqvladkdfga
    lhftgstnvfkslygkiqsgvvegkyrdypriigetggknfhlvhpsanishavlstirg
    tfefqgqkcsaasrlylpeskseeflsdmfgilqsqggnlrgfmgpviheqsfdklvkvi
    edakkdpeleilyggqydksqgwfvgptvikakrpdhpymsteffgpiltvyeypdtefn
    eicdiidntyaltgaifakdrkaieyadeklkfsagnfyindkctgnilsrfvsirntke
    nfyel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oe6B (B:)
    mdhhhhhhhhasenlyfqghmkppkhirnepvkpfrnidlkdwdllraslmkfkssslev
    plvingeriydnneralfpqtnpanhqqvlanvtqatekdvmnavkaakdakkdwynlpf
    ydrsaiflkaadlistkyrydmlaatmlgqgknvyqaeidcitelsdffryyvkyasdly
    aqqpvesadgtwnkaeyrplegfvyavspfnftaiaanligapalmgntvvwkpsqtaal
    snyllmtvleeaglpkgvinfipgdpvqvtdqvladkdfgalhftgstnvfkslygkiqs
    gvvegkyrdypriigetggknfhlvhpsanishavlstirgtfefqgqkcsaasrlylpe
    skseeflsdmfgilqsqnvvpmntsaspisggnlrgfmgpviheqsfdklvkviedakkd
    peleilyggqydksqgwfvgptvikakrpdhpymsteffgpiltvyeypdtefneicdii
    dntsqyaltgaifakdrkaieyadeklkfsagnfyindkctgavvsqqwfggarmsgtdd
    kaggpnilsrfvsirntkenfyeltdfkypsnyeelgsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oe6B (B:)
    dwdllraslmkfkssslevplvingeriydnneralfpqtnpanhqqvlanvtqatekdv
    mnavkaakdakkdwynlpfydrsaiflkaadlistkyrydmlaatmlgqgknvyqaeidc
    itelsdffryyvkyasdlyaqqpvesadgtwnkaeyrplegfvyavspfnftaiaanlig
    apalmgntvvwkpsqtaalsnyllmtvleeaglpkgvinfipgdpvqvtdqvladkdfga
    lhftgstnvfkslygkiqsgvvegkyrdypriigetggknfhlvhpsanishavlstirg
    tfefqgqkcsaasrlylpeskseeflsdmfgilqsqsggnlrgfmgpviheqsfdklvkv
    iedakkdpeleilyggqydksqgwfvgptvikakrpdhpymsteffgpiltvyeypdtef
    neicdiidntyaltgaifakdrkaieyadeklkfsagnfyindkctgnilsrfvsirntk
    enfyel